| Edit |   |
|---|
| Antigenic Specificity | dynactin 4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The dynactin 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to dynactin 4. This antibody reacts with human. The dynactin 4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human dynactin 4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: INSTAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPIEESDQGTE |
|---|
| Other Names | dynactin 4 (p62), dynactin p62 subunit, dynactin subunit 4, Dynactin subunit p62 |
|---|
| Gene, Accession # | DCTN4, Gene ID: 51164, Accession: Q9UJW0, SwissProt: Q9UJW0 |
|---|
| Catalog # | NBP2-38378 |
|---|
| Price | |
|---|
| Order / More Info | dynactin 4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|