| Edit |   |
|---|
| Antigenic Specificity | RasGEF Domain Family, Member 1A (RASGEF1A) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration. |
|---|
| Immunogen | RASGEF1 A antibody was raised using the N terminal of RASGEF1 corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL |
|---|
| Other Names | MGC84301|CG4853|6330404M18Rik|AI835194 |
|---|
| Gene, Accession # | Gene ID: 221002 |
|---|
| Catalog # | ABIN634311 |
|---|
| Price | |
|---|
| Order / More Info | RasGEF Domain Family, Member 1A (RASGEF1A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|