| Edit |   |
|---|
| Antigenic Specificity | CRY1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CRY1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CRY1. This antibody reacts with human. The CRY1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to CRY1 (cryptochrome 1, photolyase-like). The peptide sequence was selected from the N terminal of CRY1 (NP_004066). Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF. |
|---|
| Other Names | cryptochrome 1 (photolyase-like), PHLL1cryptochrome-1, photolyase-like cryptochrome 1 |
|---|
| Gene, Accession # | CRY1, Gene ID: 1407, Accession: Q16526, SwissProt: Q16526 |
|---|
| Catalog # | NBP1-69080 |
|---|
| Price | |
|---|
| Order / More Info | CRY1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|