| Edit |   |
|---|
| Antigenic Specificity | Tyrosylprotein Sulfotransferase 2/TPST2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tyrosylprotein Sulfotransferase 2/TPST2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tyrosylprotein Sulfotransferase 2/TPST2. This antibody reacts with human. The Tyrosylprotein Sulfotransferase 2/TPST2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TPST2(tyrosylprotein sulfotransferase 2) The peptide sequence was selected from the middle region of TPST2. Peptide sequence KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL. |
|---|
| Other Names | EC 2.8.2.20, TPST-2, tyrosylprotein phosphotransferase 2, tyrosylprotein sulfotransferase 2protein-tyrosine sulfotransferase 2, tyrosylprotein sulfotransferase-2 |
|---|
| Gene, Accession # | TPST2, Gene ID: 8459, Accession: O60704, SwissProt: O60704 |
|---|
| Catalog # | NBP1-60025 |
|---|
| Price | |
|---|
| Order / More Info | Tyrosylprotein Sulfotransferase 2/TPST2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|