| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tyrosine Hydroxylase |
|---|
| Clone | 3049 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tyrosine Hydroxylase Antibody (3049) from Novus Biologicals is a mouse monoclonal antibody to Tyrosine Hydroxylase. This antibody reacts with human, mouse, rat. The Tyrosine Hydroxylase Antibody (3049) has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Tyrosine Hydroxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence corresponding to AA465-528 of human tyrosine hydroxylase (UniProtKB - P07101): SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
|---|
| Other Names | DYT14, DYT5b, EC 1.14.16, EC 1.14.16.2, TH, TYH dystonia 14, Tyrosine 3-hydroxylase, tyrosine 3-monooxygenase, tyrosine hydroxylase |
|---|
| Gene, Accession # | TH, Gene ID: 7054, Accession: P07101 |
|---|
| Catalog # | NBP2-46647 |
|---|
| Price | |
|---|
| Order / More Info | Tyrosine Hydroxylase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|