| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HLA DRB3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.05 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Flow Cytometry. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been use for FACS. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HLA DRB3 Antibody from Novus Biologicals is a mouse polyclonal antibody to HLA DRB3. This antibody reacts with human. The HLA DRB3 Antibody has been validated for the following applications: Western Blot, Flow Cytometry. |
|---|
| Immunogen | HLA-DRB3 (NP_072049.2, 1 a.a. - 266 a.a.) full-length human protein. MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS |
|---|
| Other Names | DR7, HLA class II histocompatibility antigen, DR beta 3 chain, HLA class II histocompatibility antigen, DRB1-7 beta chain, HLA-DR3B, HLA-DR52, HLA-DRB1, human leucocyte antigen DRB3, major histocompatibility complex, class II, DR beta 3, MGC117330, MHC class II antigen DR beta 3 chain, MHC class II antigen DRB3, MHC class II HLA-DR beta 3 chain |
|---|
| Gene, Accession # | HLA-DRB3, Gene ID: 3125, Accession: NP_072049.2, SwissProt: NP_072049.2 |
|---|
| Catalog # | H00003125-B02P |
|---|
| Price | |
|---|
| Order / More Info | HLA DRB3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|