| Edit |   |
|---|
| Antigenic Specificity | KLK-BL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KLK-BL4 antibody. Specificity: KLK-BL4 antibody was raised against the C terminal Of Klkbl4 |
|---|
| Immunogen | KLK-BL4 antibody was raised using the C terminal Of Klkbl4 corresponding to a region with amino acids EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI |
|---|
| Other Names | KLK-BL4; KLK-BL4; KLK-BL4; Kallikrein BL4; KLKBL4; FLJ25339; KLK-BL 4; KLK-BL-4, |
|---|
| Gene, Accession # | KLK-BL4 |
|---|
| Catalog # | MBS5301533 |
|---|
| Price | |
|---|
| Order / More Info | KLK-BL4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|