| 产品详情 |
| Edit |   |
| Antigenic Specificity | SPAG9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPAG9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPAG9. This antibody reacts with human. The SPAG9 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SPAG9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVL |
| Other Names | Cancer/testis antigen 89, c-Jun NH2-terminal kinase-associated leucine zipper protein, C-Jun-amino-terminal kinase-interacting protein 4, CT89JIP4, FLJ14006, FLJ26141, FLJ34602, HLC4, HLC-6, HSS, Human lung cancer oncogene 6 protein, JLPPHETSYD1FLJ13450, JNK interacting protein, JNK/SAPK-associated protein, JNK-associated leucine-zipper protein, JNK-interacting protein 4, KIAA0516JIP-4, lung cancer oncogene 4, MAPK8IP4, Max-binding protein, MGC117291, MGC14967, MGC74461, Mitogen-activated protein kinase 8-interacting protein 4, PIG6, proliferation-inducing gene 6, Proliferation-inducing protein 6, Protein highly expressed in testis, sperm associated antigen 9, Sperm surface protein, Sperm-associated antigen 9, Sperm-specific protein, Sunday driver 1 |
| Gene, Accession # | SPAG9, Gene ID: 9043 |
| Catalog # | NBP2-56914 |
| Price | |
| Order / More Info | SPAG9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|