| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPAG6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot verified by a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPAG6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPAG6. This antibody reacts with human. The SPAG6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SPAG6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA |
|---|
| Other Names | axoneme central apparatus protein, DKFZp434I153, pf16, Protein PF16 homolog, Repro-SA-1MGC26276, sperm associated antigen 6, Sperm flagellar protein, sperm-associated antigen 6 |
|---|
| Gene, Accession # | SPAG6, Gene ID: 9576, Accession: O75602 |
|---|
| Catalog # | NBP1-80923 |
|---|
| Price | |
|---|
| Order / More Info | SPAG6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|