| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPAG4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPAG4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPAG4. This antibody reacts with human. The SPAG4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SPAG4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSDITLQHPPPSVEHTGGANSAPRDFAVFGLQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGH |
|---|
| Other Names | acrosomal protein ACR55, CT127, Outer dense fiber-associated protein SPAG4, Sad1 and UNC84 domain containing 4, sperm associated antigen 4, sperm tail protein, sperm-associated antigen 4 protein, SUN domain-containing protein 4, SUN4cancer/testis antigen 127 |
|---|
| Gene, Accession # | SPAG4, Gene ID: 6676, Accession: Q9NPE6, SwissProt: Q9NPE6 |
|---|
| Catalog # | NBP2-38937 |
|---|
| Price | |
|---|
| Order / More Info | SPAG4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|