| Edit |   |
|---|
| Antigenic Specificity | Phosphoserine phosphatase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Phosphoserine phosphatase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phosphoserine phosphatase. This antibody reacts with human. The Phosphoserine phosphatase Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PSPH(phosphoserine phosphatase) The peptide sequence was selected from the middle region of PSPH. Peptide sequence IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE. |
|---|
| Other Names | L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, phosphoserine phosphatase, PSPase, PSPEC 3.1.3.3 |
|---|
| Gene, Accession # | PSPH, Gene ID: 5723, Accession: P78330, SwissProt: P78330 |
|---|
| Catalog # | NBP1-56848-20ul |
|---|
| Price | |
|---|
| Order / More Info | Phosphoserine phosphatase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27280394 |
|---|