| Edit |   |
| Antigenic Specificity | Phosphoribosyl Pyrophosphate Amidotransferase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Phosphoribosyl Pyrophosphate Amidotransferase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phosphoribosyl Pyrophosphate Amidotransferase. This antibody reacts with human. The Phosphoribosyl Pyrophosphate Amidotransferase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to PPAT(phosphoribosyl pyrophosphate amidotransferase) The peptide sequence was selected from the N terminal of PPAT. Peptide sequence VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC. |
| Other Names | ATASE, EC 2.4.2.14, glutamine phosphoribosylpyrophosphatate amidotransferase, Glutamine phosphoribosylpyrophosphate amidotransferase, glutamine PRPP amidotransferase, GPATamidophosphoribosyltransferase, phosphoribosyl pyrophosphate amidotransferase, PRAT |
| Gene, Accession # | PPAT, Gene ID: 5471, Accession: Q06203, SwissProt: Q06203 |
| Catalog # | NBP1-52964 |
| Price | |
| Order / More Info | Phosphoribosyl Pyrophosphate Amidotransferase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |