| 产品详情 |
| Edit |   |
| Antigenic Specificity | Carbohydrate Sulfotransferase 1/CHST1/KS6ST |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbohydrate Sulfotransferase 1/CHST1/KS6ST. This antibody reacts with human, rat. The Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the N terminal of CHST1. Peptide sequence SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL. |
| Other Names | C6ST, carbohydrate (chondroitin 6/keratan) sulfotransferase 1, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, carbohydrate sulfotransferase 1, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST, KSGAL6ST, KSGal6STEC 2.8.2.21, KSST |
| Gene, Accession # | CHST1, Gene ID: 8534, Accession: O43916, SwissProt: O43916 |
| Catalog # | NBP1-62542 |
| Price | |
| Order / More Info | Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29632893 |
| 产品资料 |
|
|