| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carbohydrate Sulfotransferase 1/CHST1/KS6ST |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbohydrate Sulfotransferase 1/CHST1/KS6ST. This antibody reacts with human. The Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the middle region of CHST1. Peptide sequence YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV. |
|---|
| Other Names | C6ST, carbohydrate (chondroitin 6/keratan) sulfotransferase 1, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, carbohydrate sulfotransferase 1, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST, KSGAL6ST, KSGal6STEC 2.8.2.21, KSST |
|---|
| Gene, Accession # | CHST1, Gene ID: 8534, Accession: O43916, SwissProt: O43916 |
|---|
| Catalog # | NBP1-62370-20ul |
|---|
| Price | |
|---|
| Order / More Info | Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|