| 产品详情 |
| Edit |   |
| Antigenic Specificity | Carbohydrate Sulfotransferase 6/CHST6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Carbohydrate Sulfotransferase 6/CHST6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbohydrate Sulfotransferase 6/CHST6. This antibody reacts with human. The Carbohydrate Sulfotransferase 6/CHST6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CHST6(carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6) The peptide sequence was selected from the middle region of CHST6. Peptide sequence QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN. |
| Other Names | carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6, carbohydrate sulfotransferase 6, C-GlcNAc6ST, corneal N-acetylglucosamine 6-sulfotransferase, Corneal N-acetylglucosamine-6-O-sulfotransferase, EC 2.8.2, EC 2.8.2.-, EC 2.8.2.17, EC 2.8.2.21, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-beta, glcNAc6ST-5, Gn6st-5, GST4-beta, hCGn6ST, MCDC1, N-acetylglucosamine 6-O-sulfotransferase 5 |
| Gene, Accession # | CHST6, Gene ID: 4166, Accession: Q9GZX3, SwissProt: Q9GZX3 |
| Catalog # | NBP1-57928-20ul |
| Price | |
| Order / More Info | Carbohydrate Sulfotransferase 6/CHST6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|