| Edit |   |
|---|
| Antigenic Specificity | Carbohydrate Sulfotransferase 3/CHST3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbohydrate Sulfotransferase 3/CHST3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbohydrate Sulfotransferase 3/CHST3. This antibody reacts with human. The Carbohydrate Sulfotransferase 3/CHST3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Carbohydrate Sulfotransferase 3/CHST3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL |
|---|
| Other Names | C6ST-1, C6ST1HSD, C6STEC 2.8.2.17, carbohydrate (chondroitin 6) sulfotransferase 3, carbohydrate sulfotransferase 3, Chondroitin 6-O-sulfotransferase 1, Chondroitin 6-sulfotransferase, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0, GST-0 |
|---|
| Gene, Accession # | CHST3, Gene ID: 9469, Accession: Q7LGC8, SwissProt: Q7LGC8 |
|---|
| Catalog # | NBP2-31611 |
|---|
| Price | |
|---|
| Order / More Info | Carbohydrate Sulfotransferase 3/CHST3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|