| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carbohydrate Sulfotransferase 15/CHST15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbohydrate Sulfotransferase 15/CHST15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbohydrate Sulfotransferase 15/CHST15. This antibody reacts with human. The Carbohydrate Sulfotransferase 15/CHST15 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GALNAC4S-6ST(B cell RAG associated protein) The peptide sequence was selected from the middle region of GALNAC4S-6ST. Peptide sequence YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS. |
|---|
| Other Names | B cell RAG associated protein (GALNAC4S-6ST), B-cell RAG-associated gene protein, BRAGKIAA0598RP11-47G11.1, carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15, carbohydrate sulfotransferase 15, DKFZp781H1369, EC 2.8.2.33, GalNAc4S-6ST, GALNAC4S6ST, hBRAG, MGC34346, N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase |
|---|
| Gene, Accession # | CHST15, Gene ID: 51363, Accession: Q7LFX5, SwissProt: Q7LFX5 |
|---|
| Catalog # | NBP1-59012 |
|---|
| Price | |
|---|
| Order / More Info | Carbohydrate Sulfotransferase 15/CHST15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|