| Edit |   |
| Antigenic Specificity | RFPL4B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RFPL4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to RFPL4B. This antibody reacts with human. The RFPL4B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence MTKQHNSRLEQSLHVREELRHFREDVTLDAATASSLLVFSNDLRSAQCKK. |
| Other Names | ret finger protein-like 4B, RNF211RING finger protein 211 |
| Gene, Accession # | RFPL4B, Gene ID: 442247, Accession: Q6ZWI9, SwissProt: Q6ZWI9 |
| Catalog # | NBP1-55031 |
| Price | |
| Order / More Info | RFPL4B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |