| Edit |   |
|---|
| Antigenic Specificity | RFPL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RFPL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RFPL2. This antibody reacts with human. The RFPL2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RFPL2(ret finger protein-like 2) The peptide sequence was selected from the C terminal of RFPL2. Peptide sequence VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG. |
|---|
| Other Names | ret finger protein-like 2, RNF79RING finger protein 79 |
|---|
| Gene, Accession # | RFPL2, Gene ID: 10739, Accession: O75678, SwissProt: O75678 |
|---|
| Catalog # | NBP1-56360 |
|---|
| Price | |
|---|
| Order / More Info | RFPL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|