| Edit |   |
| Antigenic Specificity | RFPL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RFPL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RFPL2. This antibody reacts with human. The RFPL2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RFPL2(ret finger protein-like 2) The peptide sequence was selected from the C terminal of RFPL2. Peptide sequence VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG. |
| Other Names | ret finger protein-like 2, RNF79RING finger protein 79 |
| Gene, Accession # | RFPL2, Gene ID: 10739, Accession: O75678, SwissProt: O75678 |
| Catalog # | NBP1-56360 |
| Price | |
| Order / More Info | RFPL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |