| Edit |   |
|---|
| Antigenic Specificity | PHYHIPL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PHYHIPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHYHIPL. This antibody reacts with human. The PHYHIPL Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PHYHIPL (phytanoyl-CoA 2-hydroxylase interacting protein-like) The peptide sequence was selected from the C terminal of PHYHIPL. Peptide sequence QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG. |
|---|
| Other Names | Em:AC025038.1, KIAA1796phytanoyl-CoA hydroxylase interacting protein-like, phytanoyl-CoA 2-hydroxylase interacting protein-like, phytanoyl-CoA hydroxylase-interacting protein-like |
|---|
| Gene, Accession # | PHYHIPL, Gene ID: 84457, Accession: Q96FC7, SwissProt: Q96FC7 |
|---|
| Catalog # | NBP1-68963-20ul |
|---|
| Price | |
|---|
| Order / More Info | PHYHIPL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|