| Edit |   |
|---|
| Antigenic Specificity | PHYHIPL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PHYHIPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHYHIPL. This antibody reacts with human. The PHYHIPL Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PHYHIPL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNI |
|---|
| Other Names | Em:AC025038.1, KIAA1796phytanoyl-CoA hydroxylase interacting protein-like, phytanoyl-CoA 2-hydroxylase interacting protein-like, phytanoyl-CoA hydroxylase-interacting protein-like |
|---|
| Gene, Accession # | PHYHIPL, Gene ID: 84457 |
|---|
| Catalog # | NBP1-84858 |
|---|
| Price | |
|---|
| Order / More Info | PHYHIPL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|