| Edit |   |
| Antigenic Specificity | PHRF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PHRF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHRF1. This antibody reacts with human. The PHRF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PHRF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASGRVQEAARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQAFSELPF |
| Other Names | CTD binding SR like protein rA9, CTD-binding SR-like protein rA9, KIAA1542RNF221, PHD and RING finger domain-containing protein 1, PHD and ring finger domains 1 |
| Gene, Accession # | PHRF1, Gene ID: 57661, Accession: Q9P1Y6, SwissProt: Q9P1Y6 |
| Catalog # | NBP2-38979 |
| Price | |
| Order / More Info | PHRF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |