| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PHOX2A |
|---|
| Clone | 4F6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 30315878). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PHOX2A Antibody (4F6) from Novus Biologicals is a mouse monoclonal antibody to PHOX2A. This antibody reacts with human, rat. The PHOX2A Antibody (4F6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, RNA Inhibition. |
|---|
| Immunogen | PHOX2A (NP_005160, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ |
|---|
| Other Names | aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive, aristaless homeobox homolog, Aristaless homeobox protein homolog, arix homeodomain protein, ARIX1 homeodomain protein, ARIXNCAM2, CFEOM2MGC52227, paired mesoderm homeobox protein 2A, paired-like homeobox 2apaired-like (aristaless) homeobox 2a, PMX2AFEOM2 |
|---|
| Gene, Accession # | PHOX2A, Gene ID: 401, Accession: NP_005160, SwissProt: NP_005160 |
|---|
| Catalog # | H00000401-M01 |
|---|
| Price | |
|---|
| Order / More Info | PHOX2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30315878 |
|---|
| 产品资料 |
|
|