| 产品详情 |
| Edit |   |
| Antigenic Specificity | Complement Factor H |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Complement Factor H Antibody from Novus Biologicals is a rabbit polyclonal antibody to Complement Factor H. This antibody reacts with human. The Complement Factor H Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Complement Factor H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA |
| Other Names | adrenomedullin binding protein, age-related maculopathy susceptibility 1, AHUS1, AMBP1, ARMD4, beta-1H, beta-1-H-globulin, CFHL3, complement factor H, factor H, factor H-like 1, FH, FHL1, H factor 1, H factor 1 (complement), H factor 2 (complement), HF, HF1ARMS1, HF2, HUSMGC88246 |
| Gene, Accession # | CFH, Gene ID: 3075, Accession: P08603, SwissProt: P08603 |
| Catalog # | NBP2-33933 |
| Price | |
| Order / More Info | Complement Factor H Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|