| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VPS45 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VPS45 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS45. This antibody reacts with human. The VPS45 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human VPS45 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KETTGIVSMVYTQSEILQKEVYLFERIDSQNREIMKHLKAICFLRPTKENVDYIIQELRRPKYTIYFIYFSNVISKSDVKSLAEADEQEVVA |
|---|
| Other Names | H1, H1VPS45, hlVps45, h-vps45, leucocyte vacuolar protein sorting 45, vacuolar protein sorting 45 homolog (S. cerevisiae), vacuolar protein sorting 45A, vacuolar protein sorting 45A (yeast homolog), vacuolar protein sorting 45A (yeast), vacuolar protein sorting-associated protein 45, VPS45A, VPS45AVPS54A, VPS45B, VSP45, VSP45A |
|---|
| Gene, Accession # | VPS45, Gene ID: 11311 |
|---|
| Catalog # | NBP1-81642 |
|---|
| Price | |
|---|
| Order / More Info | VPS45 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|