| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VPS25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VPS25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS25. This antibody reacts with human. The VPS25 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human VPS25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL |
|---|
| Other Names | Dermal papilla-derived protein 9, DERP9, DERP9hVps25, EAP20, EAP20FAP20, ELL-associated protein of 20 kDa, ESCRT-II complex subunit VPS25, FAP20, MGC10540, vacuolar protein sorting 25 (yeast), vacuolar protein sorting 25 homolog (S. cerevisiae), vacuolar protein-sorting-associated protein 25 |
|---|
| Gene, Accession # | VPS25, Gene ID: 84313, Accession: Q9BRG1, SwissProt: Q9BRG1 |
|---|
| Catalog # | NBP2-33641 |
|---|
| Price | |
|---|
| Order / More Info | VPS25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|