| 产品详情 |
| Edit |   |
| Antigenic Specificity | UBA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UBA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBA3. This antibody reacts with human. The UBA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE |
| Other Names | DKFZp566J164, EC 6.3.2, EC 6.3.2.-, hUba3, MGC22384, NEDD8-activating enzyme E1 catalytic subunit, NEDD8-activating enzyme E1C, Nedd8-activating enzyme hUba3, UBA3, ubiquitin-activating enzyme E1 homolog, UBE1C, Ubiquitin-activating enzyme 3, Ubiquitin-activating enzyme E1C, ubiquitin-activating enzyme E1C (homologous to yeast UBA3), ubiquitin-like modifier activating enzyme 3, Ubiquitin-like modifier-activating enzyme 3, yeast) |
| Gene, Accession # | UBA3, Gene ID: 9039 |
| Catalog # | NBP2-49443 |
| Price | |
| Order / More Info | UBA3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|