| Edit |   |
| Antigenic Specificity | Rheb |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Rheb Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rheb. This antibody reacts with human. The Rheb Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to RHEB(Ras homolog enriched in brain) The peptide sequence was selected from the middle region of RHEB. Peptide sequence VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA. |
| Other Names | GTP-binding protein Rheb, MGC111559, Ras homolog enriched in brainRHEB2Ras homolog enriched in brain 2 |
| Gene, Accession # | RHEB, Gene ID: 6009, Accession: Q15382, SwissProt: Q15382 |
| Catalog # | NBP1-58861 |
| Price | |
| Order / More Info | Rheb Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |