| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PARP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PARP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PARP3. This antibody reacts with human. The PARP3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PARP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV |
|---|
| Other Names | ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 3, ADPRT-3, ADPRT3PADPRT-3, ADPRTL2, ADPRTL3NAD+ ADP-ribosyltransferase 3, EC 2.4.2.30, hPARP-3, IRT1ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 2, NAD(+) ADP-ribosyltransferase 3, pADPRT-3, PARP-3, poly (ADP-ribose) polymerase family, member 3, poly [ADP-ribose] polymerase 3, poly(ADP-ribose) synthetase-3, Poly[ADP-ribose] synthase 3, poly[ADP-ribose] synthetase 3 |
|---|
| Gene, Accession # | PARP3, Gene ID: 10039 |
|---|
| Catalog # | NBP2-49523 |
|---|
| Price | |
|---|
| Order / More Info | PARP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|