| 产品详情 |
| Edit |   |
| Antigenic Specificity | PARP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PARP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PARP2. This antibody reacts with human. The PARP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to PARP2 (poly (ADP-ribose) polymerase family, member 2) The peptide sequence was selected from the middle region of PARP2. Peptide sequence LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA. |
| Other Names | ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2, ADPRT-2, ADPRT2pADPRT-2, ADPRTL2EC 2.4.2.30, ADPRTL3, hPARP-2, NAD(+) ADP-ribosyltransferase 2, PARP-2, poly (ADP-ribose) polymerase 2, poly (ADP-ribose) polymerase family, member 2, poly (ADP-ribosyl) transferase-like 2, poly [ADP-ribose] polymerase 2, poly(ADP-ribose) synthetase, Poly[ADP-ribose] synthase 2, poly[ADP-ribose] synthetase 2 |
| Gene, Accession # | PARP2, Gene ID: 10038, Accession: Q9UGN5, SwissProt: Q9UGN5 |
| Catalog # | NBP1-54680-20ul |
| Price | |
| Order / More Info | PARP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|