| Edit |   |
| Antigenic Specificity | CD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD5. This antibody reacts with human. The CD5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDLGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQK |
| Other Names | CD5 antigen, CD5 antigen (p56-62), CD5 molecule, LEU1T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, T1 |
| Gene, Accession # | CD5, Gene ID: 921, Accession: P06127, SwissProt: P06127 |
| Catalog # | NBP2-38509 |
| Price | |
| Order / More Info | CD5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |