| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAM68 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAM68 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAM68. This antibody reacts with human. The SAM68 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human SAM68 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR |
|---|
| Other Names | FLJ34027, GAP-associated tyrosine phosphoprotein p62, KH domain containing, RNA binding, signal transduction associated 1, KH domain-containing, RNA-binding, signal transduction-associated protein 1, p21 Ras GTPase-activating protein-associated p62, p62, p68, SAM68, Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68), Src-associated in mitosis 68 kDa protein |
|---|
| Gene, Accession # | KHDRBS1, Gene ID: 10657, Accession: Q07666, SwissProt: Q07666 |
|---|
| Catalog # | NBP2-38645 |
|---|
| Price | |
|---|
| Order / More Info | SAM68 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|