| Edit |   |
| Antigenic Specificity | Endoglycan/PODXL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Endoglycan/PODXL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Endoglycan/PODXL2. This antibody reacts with human. The Endoglycan/PODXL2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human PODXL2. Peptide sequence EEEELNDSSLDLGPTADYVFPDLTEKAGSIEDTSQAQELPNLPSPLPKMN. |
| Other Names | endoglycan, PODLX2, podocalyxin-like 2, podocalyxin-like protein 2 |
| Gene, Accession # | PODXL2, Gene ID: 50512, Accession: NP_056535, SwissProt: NP_056535 |
| Catalog # | NBP1-79200-20ul |
| Price | |
| Order / More Info | Endoglycan/PODXL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |