| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | L-Selectin/CD62L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The L-Selectin/CD62L Antibody from Novus Biologicals is a rabbit polyclonal antibody to L-Selectin/CD62L. This antibody reacts with human. The L-Selectin/CD62L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD |
|---|
| Other Names | CD62L, CD62L antigen, gp90-MEL, hLHRc, LAM-1, LAM1LECAM1, Leu-8, LEU8, Leukocyte adhesion molecule 1, Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1, LNHRTQ1, LSEL, L-selectin, Lyam-1, LYAM1CD62 antigen-like family member L, Lymph node homing receptor, lymphocyte adhesion molecule 1, pln homing receptor, PLNHR, selectin L |
|---|
| Gene, Accession # | SELL, Gene ID: 6402 |
|---|
| Catalog # | NBP2-76545 |
|---|
| Price | |
|---|
| Order / More Info | L-Selectin/CD62L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|