| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LSD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LSD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LSD1. This antibody reacts with human. The LSD1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human LSD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY |
|---|
| Other Names | amine oxidase (flavin containing) domain 2, AOF2lysine-specific histone demethylase 1, BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit, Flavin-containing amine oxidase domain-containing protein 2, KIAA0601KDM1, LSD1BRAF35-HDAC complex protein BHC110, lysine (K)-specific demethylase 1, lysine (K)-specific demethylase 1A, lysine-specific histone demethylase 1A |
|---|
| Gene, Accession # | KDM1A, Gene ID: 23028 |
|---|
| Catalog # | NBP2-58483 |
|---|
| Price | |
|---|
| Order / More Info | LSD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|