| Edit |   |
| Antigenic Specificity | LRTOMT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRTOMT Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRTOMT. This antibody reacts with human. The LRTOMT Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC51(leucine rich repeat containing 51) The peptide sequence was selected from the N terminal of LRRC51. Peptide sequence MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL. |
| Other Names | leucine rich transmembrane and 0-methyltransferase domain containing, TOMT |
| Gene, Accession # | LRTOMT, Gene ID: 220074 |
| Catalog # | NBP1-70628 |
| Price | |
| Order / More Info | LRTOMT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |