| Edit |   |
| Antigenic Specificity | LRTM2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRTM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRTM2. This antibody reacts with human. The LRTM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LRTM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NNSIRTLDRDLLRHSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFKHWME |
| Other Names | Leucine-Rich Repeat And Transmembrane Domain-Containing Protein 2, Leucine-Rich Repeats And Transmembrane Domains 2 |
| Gene, Accession # | LRTM2, Gene ID: 654429, Accession: Q8N967, SwissProt: Q8N967 |
| Catalog # | NBP2-30649 |
| Price | |
| Order / More Info | LRTM2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |