| Edit |   |
| Antigenic Specificity | LRRTM1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRTM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRTM1. This antibody reacts with human. The LRRTM1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRTM1(leucine rich repeat transmembrane neuronal 1) The peptide sequence was selected form the middle region of LRRTM1. Peptide sequence CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG. |
| Other Names | FLJ32082, leucine rich repeat transmembrane neuronal 1, leucine-rich repeat transmembrane neuronal 1 protein, leucine-rich repeat transmembrane neuronal protein 1 |
| Gene, Accession # | LRRTM1, Gene ID: 347730, Accession: Q86UE6, SwissProt: Q86UE6 |
| Catalog # | NBP1-62303 |
| Price | |
| Order / More Info | LRRTM1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |