| 产品详情 |
| Edit |   |
| Antigenic Specificity | DHTKD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DHTKD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHTKD1. This antibody reacts with human. The DHTKD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DHTKD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALPLFWRGYQTERGVYGYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGL |
| Other Names | dehydrogenase E1 and transketolase domain containing 1, Dehydrogenase E1 and transketolase domain-containing protein 1, DKFZp762M115, EC 1.2.4.2, KIAA1630DKFZP762M115, MGC3090, probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial |
| Gene, Accession # | DHTKD1, Gene ID: 55526 |
| Catalog # | NBP2-55215 |
| Price | |
| Order / More Info | DHTKD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|