| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD21 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD21 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD21. This antibody reacts with human. The CD21 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS |
|---|
| Other Names | C3DRSLEB9, CD21, CD21 antigen, Complement C3d receptor, complement component (3d/Epstein Barr virus) receptor 2, complement receptor type 2, Cr2, EBV receptor, Epstein-Barr virus receptor |
|---|
| Gene, Accession # | CR2, Gene ID: 1380, Accession: P20023, SwissProt: P20023 |
|---|
| Catalog # | NBP2-38895 |
|---|
| Price | |
|---|
| Order / More Info | CD21 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|