| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LSM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LSM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LSM2. This antibody reacts with human. The LSM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LSM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
|---|
| Other Names | C6orf28chromosome 6 open reading frame 28, G7b, LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae), Protein G7b, Small nuclear ribonuclear protein D homolog, snRNP, snRNP core Sm-like protein Sm-x5, U6 snRNA-associated Sm-like protein LSm2, YBL026W |
|---|
| Gene, Accession # | LSM2, Gene ID: 57819, Accession: Q9Y333, SwissProt: Q9Y333 |
|---|
| Catalog # | NBP2-38093 |
|---|
| Price | |
|---|
| Order / More Info | LSM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|