| Edit |   |
|---|
| Antigenic Specificity | LSM12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LSM12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LSM12. This antibody reacts with human. The LSM12 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LSM12(LSM12 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of LSM12. Peptide sequence PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL. |
|---|
| Other Names | FLJ30656, LSM12 homolog (S. cerevisiae), MGC104211, PNAS-135, protein LSM12 homolog |
|---|
| Gene, Accession # | LSM12, Gene ID: 124801, Accession: Q3MHD2, SwissProt: Q3MHD2 |
|---|
| Catalog # | NBP1-56720 |
|---|
| Price | |
|---|
| Order / More Info | LSM12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|