| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSSK2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSSK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSSK2. This antibody reacts with human. The TSSK2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TSSK2(testis-specific serine kinase 2) The peptide sequence was selected from the middle region of TSSK2. Peptide sequence RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD. |
|---|
| Other Names | DGSG, DiGeorge syndrome protein G, EC 2.7.11, FLJ38613, serine/threonine kinase 22B (spermiogenesis associated), Serine/threonine-protein kinase 22B, spermiogenesis associated 2, SPOGA2EC 2.7.11.1, STK22BDGS-G, testis specific serine threonine kinase 2, Testis-specific kinase 2, testis-specific serine kinase 2, testis-specific serine/threonine-protein kinase 2, TSK-2, TSSK-2 |
|---|
| Gene, Accession # | TSSK2, Gene ID: 23617, Accession: Q96PF2, SwissProt: Q96PF2 |
|---|
| Catalog # | NBP1-52968-20ul |
|---|
| Price | |
|---|
| Order / More Info | TSSK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|