| Edit |   |
| Antigenic Specificity | PGRMC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PGRMC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGRMC1. This antibody reacts with human. The PGRMC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to PGRMC1(progesterone receptor membrane component 1) The peptide sequence was selected from the N terminal of PGRMC1. Peptide sequence MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ. |
| Other Names | HPR6.6PGRMC, membrane-associated progesterone receptor component 1, MPR, progesterone binding protein, progesterone receptor membrane component 1 |
| Gene, Accession # | PGRMC1, Gene ID: 10857, Accession: O00264, SwissProt: O00264 |
| Catalog # | NBP1-59827 |
| Price | |
| Order / More Info | PGRMC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |