| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PGRMC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB, ICC/IF reported in the literature (PMID:23242527). Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGRMC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGRMC1. This antibody reacts with human, mouse, rat. The PGRMC1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PGRMC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR |
|---|
| Other Names | HPR6.6PGRMC, membrane-associated progesterone receptor component 1, MPR, progesterone binding protein, progesterone receptor membrane component 1 |
|---|
| Gene, Accession # | PGRMC1, Gene ID: 10857 |
|---|
| Catalog # | NBP1-83220 |
|---|
| Price | |
|---|
| Order / More Info | PGRMC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18511743, 20144686, 22073374, 22147012, 22326699, 22719051, 23242527, 23396283, 23653459, 23813454, 25154666, 26988023 |
|---|
| 产品资料 |
|
|