| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PGR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB, IHC reported in scientific literature (PMID: 27867096). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGR1. This antibody reacts with human, rat. The PGR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PGR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL |
|---|
| Other Names | 15-oxoprostaglandin 13-reductase, EC 1.3.1.-, EC 1.3.1.48, EC 1.3.1.74, FLJ99229, leukotriene B4 12-hydroxydehydrogenase, LTB4DH, MGC34943, NADP-dependent leukotriene B4 12-hydroxydehydrogenase, PGR1, PRG-1, prostaglandin reductase 1, ZADH3, zinc binding alcohol dehydrogenase domain containing 3 |
|---|
| Gene, Accession # | PTGR1, Gene ID: 22949 |
|---|
| Catalog # | NBP1-87892 |
|---|
| Price | |
|---|
| Order / More Info | PGR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27867096 |
|---|
| 产品资料 |
|
|