| Edit |   |
|---|
| Antigenic Specificity | FAM164C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM164C Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM164C. This antibody reacts with human. The FAM164C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C14ORF140 The peptide sequence was selected from the N terminal of C14ORF140. Peptide sequence QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK. |
|---|
| Other Names | C14orf140, chromosome 14 open reading frame 140, family with sequence similarity 164, member C, FLJ23093 |
|---|
| Gene, Accession # | ZC2HC1C, Gene ID: 79696, Accession: Q53FD0, SwissProt: Q53FD0 |
|---|
| Catalog # | NBP1-57701 |
|---|
| Price | |
|---|
| Order / More Info | FAM164C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|