| Edit |   |
| Antigenic Specificity | FAM164C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM164C Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM164C. This antibody reacts with human. The FAM164C Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C14ORF140 The peptide sequence was selected from the N terminal of C14ORF140. Peptide sequence QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK. |
| Other Names | C14orf140, chromosome 14 open reading frame 140, family with sequence similarity 164, member C, FLJ23093 |
| Gene, Accession # | ZC2HC1C, Gene ID: 79696, Accession: Q53FD0, SwissProt: Q53FD0 |
| Catalog # | NBP1-57701-20ul |
| Price | |
| Order / More Info | FAM164C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |