| Edit |   |
| Antigenic Specificity | Methyltransferase like 5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Methyltransferase like 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Methyltransferase like 5. This antibody reacts with human. The Methyltransferase like 5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to METTL5(methyltransferase like 5) The peptide sequence was selected from the N terminal of METTL5. Peptide sequence KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE. |
| Other Names | EC 2.1.1.-, FLJ10459, HSPC133, methyltransferase like 5, methyltransferase-like protein 5 |
| Gene, Accession # | METTL5, Gene ID: 29081, Accession: Q9NRN9, SwissProt: Q9NRN9 |
| Catalog # | NBP1-56420-20ul |
| Price | |
| Order / More Info | Methyltransferase like 5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |