| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CEP290 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEP290 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEP290. This antibody reacts with human. The CEP290 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CEP290 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAELT |
|---|
| Other Names | BBS14Bardet-Biedl syndrome 14 protein, Cancer/testis antigen 87, centrosomal protein 290kDa, Cep290, CT87JBTS6, FLJ13615, JBTS5CTCL tumor antigen se2-2, KIAA0373FLJ21979, LCA10monoclonal 3H11 antigen, MKS4, Nephrocystin-6, NPHP6centrosomal protein of 290 kDa, POC3, POC3 centriolar protein homolog, prostate cancer antigen T21, rd16,3H11AG, SLSN6nephrocytsin-6,3H11Ag, Tumor antigen se2-2 |
|---|
| Gene, Accession # | CEP290, Gene ID: 80184, Accession: O15078, SwissProt: O15078 |
|---|
| Catalog # | NBP2-33406 |
|---|
| Price | |
|---|
| Order / More Info | CEP290 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|